N0573-ML490
NDST1 (Bifunctional Heparan Sulfate N-deacetylase/N-sulfotransferase 1, Glucosaminyl N-deacetylase/N-sulfotransferase 1, NDST-1, [Heparan Sulfate]-Glucosamine N-sulfotransferase 1, HSNST 1, N-heparan Sulfate Sulfotransferase 1, N-HSST 1, HSST, HSST1) (Azide Free) (MaxLight 490)
Größe
£914.00
- SKU:
- N0573-ML490
- Reinheit:
- Purified by ammonium sulfate precipitation.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant protein corresponding to aa38-136 of human NDST1 (NP_001534) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 11C463
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™490.
- Weitere Details:
- MaxLight™490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000. NDST1 is an essential bifunctional enzyme that catalyzes both the N-deacetylation and the N-sulfation of glucosamine (GlcNAc) of the glycosaminoglycan in heparan sulfate. Modifies the GlcNAc-GlcA dissacharide repeating sugar backbone to make N-sulfated heparosan, a prerequisite substrate for later modifications in heparin biosynthesis. Plays a role in determining the extent and pattern of sulfation of heparan sulfate. Compared to other NDST enzymes, its presence is absolutely required. Participates in biosynthesis of heparan sulfate that can ultimately serve as L-selectin ligands, thereby playing a role in inflammatory response. Applications: Suitable for use in FLISA, Immunohistochemistry and Western Blot. Other applications not tested. Recommended Dilutions: Western Blot: 1:500-1:1000 Immunohistochemistry (formalin-fixed, paraffin-embedded): 3ug/ml Optimal dilutions to be determined by the researcher. Amino Acid Sequence: LYGWKRGLEPSADAPEPDCGDPPPVAPSRLLPLKPVQAATPSRTDPLVLVFVESLYSQLGQEVVAILESSRFKYRTEIAPGKGDMPTLTDKGRGRFALI Positive Control: Human small intestine, A549 cells. Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice