LY6E (Lymphocyte Antigen 6E, Ly-6E, Retinoic Acid-induced Gene E Protein, RIG-E, Stem Cell Antigen 2, SCA-2, Thymic Shared Antigen 1, TSA-1, 9804, RIGE, SCA2, TSA1)

Größe

£760.00

SKU:: L7715-05Q
Anwendung:: WB
Reinheit:: Purified.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Rabbit
Immunogen:: Full-length recombinant protein corresponding to aa1-131 from human LY6E.
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: Applications: Suitable for use in Western Blot.. Other applications not tested. Recommended Dilutions: Western Blot: 1ug/ml Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MKIFLPVLLAALLGVERASSLMCFSCLNQKSNLYCLKPTICSDQDNYCVTVSASAGIGNLVTFGHSLSKTCSPACPIPEGVNVGVASMGISCCQSFLCNFSAADGGLRASVTLLGAGLLLSLLPALLRFGP Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.