L7715-05Q-HRP
LY6E (Lymphocyte Antigen 6E, Ly-6E, Retinoic Acid-induced Gene E Protein, RIG-E, Stem Cell Antigen 2, SCA-2, Thymic Shared Antigen 1, TSA-1, 9804, RIGE, SCA2, TSA1) (HRP)
Größe
£934.00
- SKU:
- L7715-05Q-HRP
- Anwendung:
- WB
- Reinheit:
- Purified.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Rabbit
- Immunogen:
- Full-length recombinant protein corresponding to aa1-131 from human LY6E.
- Format:
- Supplied as a liquid in PBS, pH 7.4. No preservative added. Labeled with Horseradish peroxidase (HRP).
- Weitere Details:
- Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MKIFLPVLLAALLGVERASSLMCFSCLNQKSNLYCLKPTICSDQDNYCVTVSASAGIGNLVTFGHSLSKTCSPACPIPEGVNVGVASMGISCCQSFLCNFSAADGGLRASVTLLGAGLLLSLLPALLRFGP Storage and Stability Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice