F4208-57H

Fibroblast Activation Protein alpha (FAPa, FAP, 170kD Melanoma Membrane-bound Gelatinase, DKFZP686G13158, DPPIV, EC 3.4.21.-, Integral Membrane Serine Protease, Seprase) (Azide Free)

Größe

£685.00

SKU:: F4208-57H
Reinheit:: Purified
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa525-625 of human FAP with a GST tag. MW of the GST tag alone is 26kD.
Klon:: 10C243
Format:: Supplied as a liquid in PBS, pH 7.4. No preservative added (Azide free).
Weitere Details:: The protein encoded by this gene is a homodimeric integral membrane gelatinase belonging to the serine protease family. It is selectively expressed in reactive stromal fibroblasts of epithelial cancers, granulation tissue of healing wounds, and malignant cells of bone and soft tissue sarcomas. This protein is thought to be involved in the control of fibroblast growth or epithelial-mesenchymal interactions during development, tissue repair, and epithelial carcinogenesis. Applications: Suitable for use in Western Blot, ELISA and Immunoprecipitation. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: PPQFDRSKKYPLLIQVYGGPCSQSVRSVFAVNWISYLASKEGMVIALVDGRGTAFQGDKLLYAVYRKLGVYEVEDQITAVRKFIEMGFIDEKRIAIWGWS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.