E9007-85E

Exonuclease I (Exonuclease-I, ExoI, Exonuclease 1, Exonuclease-1, Exo1, HEX1, hExo1, hExoI, Rad2 Nuclease Family Member Homolog of S. cerevisiae Exonuclease 1) (Azide Free)

Größe

£685.00

SKU:: E9007-85E
Reinheit:: Purified
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa747-846 from human Exonuclease I, with GST tag. MW of the GST tag alone is 26kD.
Klon:: 10C180
Format:: Supplied as a liquid in PBS, pH 7.4. No preservative added (Azide free).
Weitere Details:: This gene encodes a protein with 5' to 3' exonuclease activity as well as an RNase H activity. It is similar to the Saccharomyces cerevisiae protein Exo1 which interacts with Msh2 and which is involved in mismatch repair and recombination. Alternative splicing of this gene results in three transcript variants encoding two different isoforms. Applications: Suitable for use in ELISA and Western Blot. Other applications have not been tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. AA Sequence: ADSLSTTKIKPLGPARASGLSKKPASIQKRKHHNAENKPGLQIKLNELWKNFGFKKDSEKLPPCKKPLSPVRDNIQLTPEAEEDIFNKPECGRVQRAIFQ Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.