E3410-10

EGF, Recombinant, Human, Animal Free (Epidermal Growth Factor, Urogastrone, URG)

Größe

£320.00

SKU:: E3410-10
Molekulargewicht:: 6.2
Reinheit:: ≥98% (SDS-PAGE and HPLC) Endotoxin: ≤0.1ng/ug (1EU/ug).
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Format:: Supplied as a lyophilized powder. No additives. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml. Add 0.1% HSA or BSA for long term storage. Do not vortex.
Weitere Details:: Epidermal Growth Factor (EGF) is a polypeptide growth factor which stimulates the proliferation of a wide range of epidermal and epithelial cells. Human EGF is a 6.2kD protein containing 53 amino acid residues. Amino Acid Sequence: NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR Biological Activity: Determined by its ability to stimulate the proliferation of murine BALB/c 3T3 cells. The expected ED50 is ≤0.1ng/ml corresponding to a specific activity of ≥1x10e7units/mg. Protein Content: Verified by UV Spectroscopy an/or SDS-PAGE gel. Storage and Stability: Lyophilized powder may be stored at -20°C. Stable for 6 months after receipt at -20°C. Reconstitute with sterile buffer. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.