E2239-15A

ELAVL4 (ELAV-like Protein 4, Hu-antigen D, HuD, Paraneoplastic Encephalomyelitis Antigen HuD, HUD, PNEM)

Größe

£685.00

SKU:: E2239-15A
Reinheit:: Purified
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa312-380 from human ELAVL4 with GST tag. MW of the GST tag alone is 26kD.
Klon:: 6B9
Format:: Supplied as a liquid in PBS, pH 7.4
Weitere Details:: Applications: Suitable for use in ELISA, Immunohistochemistry and Western Blot. Other applications not tested. Recommended Dilutions: Immunohistochemistry: Paraffin sections Optimal dilutions to be determined by the researcher. Amino Acid Sequence: VLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSFKTNKAHKS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.