E2239-15A-APC

ELAVL4 (ELAV-like Protein 4, Hu-antigen D, HuD, Paraneoplastic Encephalomyelitis Antigen HuD, HUD, PNEM) (APC)

Größe

£927.00

SKU:: E2239-15A-APC
Reinheit:: Purified.
Lagerbedingungen:: 4°C Do Not Freeze
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa312-380 from human ELAVL4 with GST tag. MW of the GST tag alone is 26kD.
Klon:: 6B9
Format:: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
Weitere Details:: Applications: Suitable for use in FLISA, Immunohistochemistry and Western Blot. Other applications not tested. Recommended Dilutions: Immunohistochemistry: Parafin sections Optimal dilutions to be determined by the researcher. Amino Acid Sequence: VLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSFKTNKAHKS Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.