CEACAM 21 (CEACAM21, Carcinoembryonic Antigen-related Cell Adhesion Molecule 21, UNQ3098/PRO10075) (Biotin)

Größe

£934.00

SKU:: C2589-87P-BIOTIN
Anwendung:: WB
Reinheit:: Purified
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Rabbit
Immunogen:: Full length protein corresponding to aa1-191 of human CEACAM21 (AAH12001.1)
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Weitere Details:: Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilutions: Western Blot (Tissue lysate): 1:500-1:1000 using human liver lysates Western Blot (Transfected lysate): 1:1000-1:2000 detects a band at ~21.5kD using CEACAM21 transfected 293T lysate. Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MGPPSACPHRECIPWQGLLLTASLLTFWNAPTTAWLFIASAPFEVAEGENVHLSVVYLPENLYSYGWYKGKTVEPNQLIAAYVIDTHVRTPGPAYSGRETISPSGDLHFQNVTLEDTGYYNLQVTYRNSQIEQASHHLRVYGECSKFDSEISEDAAWPQDTFCWSLYPQSQWLSPPSKPAAPQSQRRAPWS Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.