C2578-05

Cdk8 (Cyclin-dependent Kinase 8, Cdk 8, Cell Division Protein Kinase 8, K35, Mediator Complex Subunit CDK8, MGC126074, MGC126075, Protein Kinase K35)

Größe

£685.00

SKU:: C2578-05
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: 4°C/-20°C (No Glycerol)
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Recombinant protein corresponding to aa375-464 of human CDK8, partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Klon:: 6H5
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Applications: Suitable for use in ELISA, Western Blot. Other applications not tested. Recommended Dilution: Western Blot: 0.1-10ug/ml Optimal dilutions to be determined by the researcher. Hybridoma: Sp2/0 myeloma cells with spleen cells from Balb/c mice. Sequence: QQQGNNHTNGTGHPGNQDSSHTQGPPLKKVRVVPPTTTSGGLIMTSDYQRSNPHAAYPNPGPSTSQPQSSMGYSATSQQPPQYSHQTHRY Storage and Stability: May be stored at 4°C for short-term only. For long-term storage and to avoid repeated freezing and thawing, add sterile 40-50% glycerol, aliquot and store at -20°C. Aliquots are stable for at least 12 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.