C2578-05-APC

Cdk8 (Cyclin-dependent Kinase 8, Cdk 8, Cell Division Protein Kinase 8, K35, Mediator Complex Subunit CDK8, MGC126074, MGC126075, Protein Kinase K35) (APC)

Größe

£927.00

SKU:: C2578-05-APC
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: 4°C Do Not Freeze
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Recombinant protein corresponding to aa375-464 of human CDK8, partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Klon:: 6H5
Format:: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
Weitere Details:: Applications: Suitable for use in FLISA, Western Blot. Other applications not tested. Recommended Dilution: Western Blot: 0.1-10ug/ml Optimal dilutions to be determined by the researcher. Hybridoma: Sp2/0 myeloma cells with spleen cells from Balb/c mice. Sequence: QQQGNNHTNGTGHPGNQDSSHTQGPPLKKVRVVPPTTTSGGLIMTSDYQRSNPHAAYPNPGPSTSQPQSSMGYSATSQQPPQYSHQTHRY Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.