C2099-68W

CCR4-Not Transcription Complex, Subunit 2 (CNOT2, CDC36, HSPC131, Negative Regulator of Transcription Subunit 2 Homolog, NOT2H)

Größe

£659.00

SKU:: C2099-68W
Reinheit:: Purified by Protein G affinity chromatography from hybridoma culture supernatant
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to human CCR4-Not Transcription Complex, Subunit 2 corresponding to amino acids within the internal portion of the protein. Immunogen sequence: FPALADRNRREGSGNPTPLINPLAGRAPYVGMVTKPANEQSQDFSIHNEDFPALPGSSYKDPTSSNDDSKSNLNTSGKTTSSTDGPKFPGDKSSTTQNNNQQKKGIQVLP
Klon:: 2191C2a
Format:: Supplied as a liquid in PBS, pH 7.4, 1% BSA, 0.05% sodium azide.
Weitere Details:: The CCR4-Not complex is a highly conserved regulator of mRNA metabolism. Applications: Suitable for use in Western Blot and Dot Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.