Calcitonin (Alpha CGRP, CALC1, CALCA, Calcitonin related polypeptide alpha, CGRP1, CGRP, CT, Katacalcin, KC) (Not for Export EU)

Größe

£326.00

SKU:: C0115-08G
Anwendung:: RIA
Reinheit:: Serum
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Rabbit
Immunogen:: Synthetic peptide corresponding to CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP from human Calcitonin, conjugated to BSA
Format:: Supplied as a lyophilized powder. Reconstitute with 20ul or 100ul sterile ddH2O.
Weitere Details:: Applications: Suitable for use in RIA. Other applications not tested. Recommended Dilutions: RIA: 1:15,000 Optimal dilutions to be determined by the researcher. Storage and Stability: Lyophilized and reconstituted products are stable for 12 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.