B2702-33D
Brain Natriuretic Peptide, aa1-32 (BNP)
Größe
£416.00
- SKU:
- B2702-33D
- Reinheit:
- Purified by Protein G affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Synthetic human BNP (aa 1-32) KLH conjugated (SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH)
- Klon:
- 21-46
- Format:
- Supplied as a lyophilized powder in PBS, pH 7.2. Reconstitute in ddH2O.
- Weitere Details:
- Human brain natriuretic peptide (BNP) is a secreted protein which is a member of the natriuretic peptide family. BNP is a cardiac hormone, which is synthesized as a pro-hormone (proBNP), and is proteolytically cleaved to release a biologically active fragment (BNP), and an inactive fragment (NT-proBNP) into the circulation. BNP is predominantly secreted from the cardiac ventricles in response to volume and pressure overload, and results in a number of biological activities including natriuresis, diuresis, vasorelaxation, and inhibition of the sympathetic nervous system. A high concentration of BNP in the bloodstream is indicative of heart failure. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Lyophilized powder may be stored at 4°C for short-term only. Reconstitute to nominal volume by adding sterile 40-50% glycerol and store at -20°C. Reconstituted product is stable for 12 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
- Versandbedingungen:
- Blue Ice