B2702-03E

Brain Natriuretic Peptide, Pro, NT, aa1-76, Recombinant, Human (NT-proBNP, N-terminal prohormone brain natriuretic peptide)

Größe

£576.00

SKU:: B2702-03E
Molekulargewicht:: 8.4
Reinheit:: ≥95% (capillary gel electrophoresis)
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Format:: Supplied as a lyophilized powder in 200mM ammonium acetate, pH 7.0. No preservative added. Reconstitute with 10ul sterile ddH2O.
Weitere Details:: Recombinant protein corresponding to Human pro-Brain Natriuretic Peptide (proBNP), N-terminal (aa1-76) expressed in E. coli. Molecular Weight: 8.4kD. Does not contain a fusion partner. Amino Acid Sequence: APLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSRE VATEGIRGHRKMVLYTLRAPR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.