B0899-03G
BD1, aa1-36 (beta Defensin-1)
Größe
£371.00
- SKU:
- B0899-03G
- Reinheit:
- Purified from cell culture supernatant by Protein G affinity chromatography
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Synthetic human β-Defensin 1 (aa 1-36) (3 disulfide bridges) (DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK)
- Klon:
- M4-14b-H4
- Format:
- Supplied as a lyophilized powder in TBS, pH 7.4. Reconstitute with ddH2O.
- Weitere Details:
- Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Western Blotting: 1:1000-1:2000 Optimal dilutions to be determined by the researcher. Storage and Stability: Lyophilized and reconstituted products are stable for 12 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
- Versandbedingungen:
- Blue Ice