A4153-03
Atrial Natriuretic Peptide, pro-, aa1-30 (ANP, ANF, Atrial natriuretic factor, Atrial natriuretic factor precursor, CDD ANF, Natriuretic Peptide Precursor A, NPPA, PND, Prepronatriodilatin, Cardiodilatin-related peptide) (Not for Export EU)
Größe
£364.00
- SKU:
- A4153-03
- Reinheit:
- Serum
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Sheep
- Immunogen:
- Synthetic human pro-ANP (aa 1-30) polylysine conjugated (NPMYNAVSNADLMDFKNLLDHLEEKMPLED)
- Format:
- Supplied as a lyophilized powder. Reconstitute with sterile dH2O.
- Weitere Details:
- Applications: Suitable for use in ELISA, RIA. Other applications not tested. Recommended Dilution: RIA: 1:5000 Optimal dilutions to be determined by the researcher. Storage and Stability: Lyophilized and reconstituted products are stable for 12 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
- Versandbedingungen:
- Blue Ice