586971
Interleukin-20 receptor subunit alpha, Active, Recombinant, Human, His-Tag, aa30-250 (IL20RA)
Größe
£326.00
- SKU:
- 586971
- Molekulargewicht:
- 26.3
- Reinheit:
- ≥95% (SDS-PAGE) Endotoxin: ≤1EU/ug (LAL)
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Format:
- Supplied as a lyophilized powder from 20mM PBS, pH 7.2. Reconstitute with sterile ddH2O, 0.1% BSA to a concentration of 0.1-1.0mg/ml.
- Weitere Details:
- The IL20RA/IL20RB dimer is a receptor for IL19, IL20 and IL24. The IL20RA/IL10RB dimer is a receptor for IL26. Partial recombinant protein corresponding to aa30-250 from human Interleukin 20 receptor subunit alpha, fused to 6xHis-Tag at C-terminal, expressed in Mammalian cells. Molecular Weight: ~26.3kD Biological Activity: The ED50 as determined by its ability to bind Human IL-20 in functional ELISA is less than 10ug/ml. Amino Acid Sequence: VPCVSGGLPKPANITFLSINMKNVLQWTPPEGLQGVKVTYTVQYFIYGQKKWLNKSECRNINRTYCDLSAETSDYEHQYYAKVKAIWGTKCSKWAESGRFYPFLETQIGPPEVALTTDEKSISVVLTAPEKWKRNPEDLPVSMQQIYSNLKYNVSVLNTKSNRTWSQCVTNHTLVLTWLEPNTLYCVHVESFVPGPPRRAQPSEKQCARTLKDQSSEFKAK Storage and Stability: Lyophilized and reconstituted products are stable for 12 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
- Versandbedingungen:
- Blue Ice