586959
Interleukin-17A, Active, Recombinant, Human, aa24-155 (IL17A)
Größe
£288.00
- SKU:
- 586959
- Molekulargewicht:
- 15.26
- Reinheit:
- ≥95% (SDS-PAGE) Endotoxin: ≤1EU/ug (LAL)
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Format:
- Supplied as a lyophilized powder from PBS, pH 7.4. Reconstitute with sterile ddH2O, 0.1% BSA to a concentration of 0.1-1.0mg/ml.
- Weitere Details:
- Ligand for IL17RA and IL17RC Recombinant protein corresponding to aa24-155 from human Interleukin 17A, expressed in E. coli. Molecular Weight: ~15.26 kD Biological Activity: The ED50 as determined by its ability to induce IL-6 secretion by NIH 3T3 mouse embryonic fibroblast cells is less than 10ng/ml. Amino Acid Sequence: GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
- Versandbedingungen:
- Blue Ice