585979
Protein K3, Recombinant, Vaccinia Virus, aa1-88, His-Tag
Größe
£626.00
- SKU:
- 585979
- Molekulargewicht:
- 11.6
- Reinheit:
- ≥85% (SDS-PAGE)
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Format:
- Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
- Weitere Details:
- Viral mimic of eIF-2-alpha that acts as a pseudosubstrate for EIF2AK2/PKR kinase. Inhibits therefore eIF-2-alpha phosphorylation by host EIF2AK2/PKR kinase and prevents protein synthesis shutoff. Source: Recombinant protein corresponding to aa1-88 from Vaccinia virus Protein K3, fused to 6X His-Tag at N-terminal, expressed in Baculovirus. Molecular Weight: ~11.6kD Amino Acid Sequence: MLAFCYSLPNAGDVIKGRVYEKDYALYIYLFDYPHFEAILAESVKMHMDRYVEYRDKLVGKTVKVKVIRVDYTKGYIDVNYKRMCRHQ Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
- Versandbedingungen:
- Blue Ice