585821
Pollen Allergen Dac g 3, Recombinant, Dactylis glomeRata, aa1-96, His-Tag
Größe
£598.00
- SKU:
- 585821
- Molekulargewicht:
- 12.9
- Reinheit:
- ≥90% (SDS-PAGE)
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Format:
- Supplied as a liquid in Tris, 50% glycerol
- Weitere Details:
- Source: Recombinant protein corresponding to aa1-96 from Dactylis glomeRata Pollen allergen Dac g 3, fused to 6X His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~12.9kD Amino Acid Sequence: VKVTFKVEKGSDPKKLVLDIKYTRPGDTLAEVELRQHGSEEWEPLTKKGNLWEVKSSKPLTGPFNFRFMSKGGMRNVFDEVIPTAFKIGTTYTPEE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
- Versandbedingungen:
- Blue Ice