585738
Pesticidal Crystal Protein Cry1Ab, Recombinant, Bacillus thuringiensis subsp. kurstaki, aa1022-1155, His-Tag
Größe
£598.00
- SKU:
- 585738
- Molekulargewicht:
- 17.3
- Reinheit:
- ≥90% (SDS-PAGE)
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Format:
- Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
- Weitere Details:
- Promotes colloidosmotic lysis by binding to the midgut epithelial cells of many lepidopteran larvae. Recombinant protein corresponding to aa1022-1155 from Bacillus thuringiensis subsp. kurstaki Pesticidal crystal protein Cry1Ab, fused to 6X His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~17.3kD Amino Acid Sequence: HEIENNTDELKFSNCVEEEVYPNNTVTCNDYTATQEEYEGTYTSRNRGYDGAYESNSSVPADYASAYEEKAYTDGRRDNPCESNRGYGDYTPLPAGYVTKELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
- Versandbedingungen:
- Blue Ice