585408
Mite Allergen Der p 3, Recombinant, Dermatophagoides pteronyssinus, aa19-261, His-Tag
Größe
£633.00
- SKU:
- 585408
- Molekulargewicht:
- 30.1
- Reinheit:
- ≥85% (SDS-PAGE)
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Format:
- Supplied as a lyophilized powder from 10mM Tris-HCl, 1mM EDTA, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml
- Weitere Details:
- Full-length recombinant protein corresponding to aa19-261 from Dermatophagoides pteronyssinus Mite allergen Der p 3, fused to 6X His-Tag at N-terminal, expressed in E. coli. Swiss/Uniprot: P39675 Molecular Weight: ~30.1kD Amino Acid Sequence: NPILPASPNATIVGGEKALAGECPYQISLQSSSHFCGGTILDEYWILTAAHCVAGQTASKLSIRYNSLKHSLGGEKISVAKIFAHEKYDSYQIDNDIALIKLKSPMKLNQKNAKAVGLPAKGSDVKVGDQVRVSGWGYLEEGSYSLPSELRRVDIAVVSRKECNELYSKANAEVTDNMICGGDVANGGKDSCQGDSGGPVVDVKNNQVVGIVSWGYGCARKGYPGVYTRVGNFIDWIESKRSQ Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
- Versandbedingungen:
- Blue Ice