585306
Major Pollen Allergen Dac g 4, Recombinant, Dactylis glomerata, aa1-55, His-SUMO-Tag
Größe
£633.00
- SKU:
- 585306
- Molekulargewicht:
- 22.4
- Reinheit:
- ≥90% (SDS-PAGE)
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Format:
- Supplied as a liquid in Tris, 50% glycerol
- Weitere Details:
- Source: Recombinant protein corresponding to aa1-55 from Dactylis glomerata Major pollen allergen Dac g 4, fused to 6X His-SUMO-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~22.4kD Amino Acid Sequence: DIYNYMEPYVSKVDPTDYFGNEQARTAWVDSGAQLGELSYGVLFNIQYVNYWFAP Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
- Versandbedingungen:
- Blue Ice