Inositol Phosphorylceramide Synthase Catalytic Subunit AUR1, Recombinant, Saccharomyces cerevisiae, aa313-401, His-B2M-Tag, Myc-Tag

Größe

£555.00

SKU:: 584961
Molekulargewicht:: 26.7
Reinheit:: ≥85% (SDS-PAGE)
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Format:: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
Weitere Details:: Catalytic component of the inositol phosphorylceramide synthase which catalyzes the addition of a phosphorylinositol group onto ceramide to form inositol phosphorylceramide, an essential step in sphingolipid biosynthesis. Source: Recombinant protein corresponding to aa313-401 from Saccharomyces cerevisiae Inositol phosphorylceramide synthase catalytic subunit AUR1, fused to 10X His-B2M-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~26.7kD Amino Acid Sequence: TKYTHLPIVDTSLFCRWSYTSIEKYDISKSDPLAADSNDIESVPLSNLELDFDLNMTDEPSVSPSLFDGSTSVSRSSATSITSLGVKRA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.