584624
Ganglioside GM2 Activator, Recombinant, Human, aa32-193, His-SUMO-Tag
Größe
£499.00
- SKU:
- 584624
- Molekulargewicht:
- 33.6
- Reinheit:
- ≥85% (SDS-PAGE)
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Format:
- Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
- Weitere Details:
- G-protein coupled receptor for glucagon-like peptide 1 (GLP-1). Recombinant protein corresponding to aa32-193 from human Ganglioside GM2 activator, fused to 6X His-SUMO-Tag at N-terminal, expressed in E. coli. Unprot/Accession: P17900 Molecular Weight: ~33.6kD Amino Acid Sequence: SSFSWDNCDEGKDPAVIRSLTLEPDPIIVPGNVTLSVMGSTSVPLSSPLKVDLVLEKEVAGLWIKIPCTDYIGSCTFEHFCDVLDMLIPTGEPCPEPLRTYGLPCHCPFKEGTYSLPKSEFVVPDLELPSWLTTGNYRIESVLSSSGKRLGCIKIAASLKGI Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
- Versandbedingungen:
- Blue Ice