584505
Fatty Acid-binding Protein, Heart, Recombinant, Rat, aa2-133, His-Tag
Größe
£570.00
- SKU:
- 584505
- Molekulargewicht:
- 18.6
- Reinheit:
- ≥90% (SDS-PAGE)
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Format:
- Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
- Weitere Details:
- FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters. Source: Recombinant protein corresponding to aa2-133 from rat Fatty acid-binding protein, fused to 6X His-Tag at N-terminal, expressed in Mammalian cell. Molecular Weight: ~18.6kD Amino Acid Sequence: ADAFVGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDTITIKTHSTFKNTEISFQLGVEFDEVTADDRKVKSVVTLDGGKLVHVQKWDGQETTLTRELSDGKLILTLTHGNVVSTRTYEKEA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
- Versandbedingungen:
- Blue Ice