Exotoxin A Regulatory Protein, Recombinant, Pseudomonas aeruginosa, aa1-259, His-KSI-Tag

Größe

£633.00

SKU:: 584479
Molekulargewicht:: 44.2
Reinheit:: ≥85% (SDS-PAGE)
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Format:: Supplied as a liquid in Tris, pH 8.0, 50% glycerol
Weitere Details:: Positive regulation of toxA gene transcription. Source: Recombinant protein corresponding to aa1-259 from Pseudomonas aeruginosa Exotoxin A regulatory protein, fused to 6X His-KSI-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~44.2kD Amino Acid Sequence: MTATDRTPPPLKWLCLGNRDANDGFELFAHGIYARNGALVGSKLSLRERRQRVDLSAFLSGAPPLLAEAAVKHLLARLLCVHRHNTDLELLGKNFIPLHASSLGNAGVCERILASARQLQQHQVELCLLLAIDEQEPASAEYLTSLARLRDSGVRIALHPQRIDTDARQCFAEVDAGLCDYLGLDARLLAPGPLTRNLRQRKSIEYLNRLLVAQDIQMLCLNVDNEELHQQANALPFAFRHGRHYSEPFQAWPFSSPAC Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.