Endo-beta-N-acetylglucosaminidase H, Recombinant, Streptomyces plicatus, aa45-313, His-Tag

Größe

£598.00

SKU:: 584363
Molekulargewicht:: 31.2
Reinheit:: ≥90% (SDS-PAGE)
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Format:: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
Weitere Details:: Cleaves asparagine-linked oligomannose and hybrid, but not complex, oligosaccharides from glycoproteins. Source: Recombinant protein corresponding to aa45-313 from Streptomyces plicatus Endo-beta-N-acetylglucosaminidase H, fused to 6X His-Tag at C-terminal, expressed in Yeast. Molecular Weight: ~31.2kD Amino Acid Sequence: APVKQGPTSVAYVEVNNNSMLNVGKYTLADGGGNAFDVAVIFAANINYDTGTKTAYLHFNENVQRVLDNAVTQIRPLQQQGIKVLLSVLGNHQGAGFANFPSQQAASAFAKQLSDAVAKYGLDGVDFDDEYAEYGNNGTAQPNDSSFVHLVTALRANMPDKIISLYNIGPAASRLSYGGVDVSDKFDYAWNPYYGTWQVPGIALPKAQLSPAAVEIGRTSRSTVADLARRTVDEGYGVYLTYNLDGGDRTADVSAFTRELYGSEAVRTP Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.