584114
Cyanovirin-N Homolog, Recombinant, Ceratopteris richardii, aa28-142
Größe
£673.00
- SKU:
- 584114
- Molekulargewicht:
- 12.4
- Reinheit:
- ≥90% (SDS-PAGE)
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Format:
- Supplied as a liquid in Tris, 50% glycerol
- Weitere Details:
- Mannose-binding lectin. Source: Recombinant protein corresponding to aa28-142 from Ceratopteris richardii Cyanovirin-N homolog, expressed in Yeast. Molecular Weight: ~12.4kD Amino Acid Sequence: QCNFANSCTGVELYGYILRGDCINEDGHPHATSINLNYYIGNDNGRLEYPGESFGSSCVKTALNDGHTLTASCKGADGQYHDSSMDLNYVVGNSYGYMEPCRASNADHVLKSSSE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
- Versandbedingungen:
- Blue Ice