Beta-lactamase SHV-5, Recombinant, Klebsiella pneumoniae, aa22-286, His-Tag, Myc-Tag

Größe

£633.00

SKU:: 583788
Molekulargewicht:: 36.3
Reinheit:: ≥90% (SDS-PAGE)
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Format:: Supplied as a liquid in Tris, 50% glycerol
Weitere Details:: SHV enzymes hydrolyze broad spectrum cephalosporins notably cefotaxime and ceftazidime. SHV-5 causes particularly high levels of resistance to aztreonam and ceftazidime. Source: Recombinant protein corresponding to aa22-286 from Klebsiella pneumoniae Beta-lactamase SHV-5, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~36.3kD Amino Acid Sequence: SPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGASKRGARGIVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.