551784
TPP1
Größe
£843.00
- SKU:
- 551784
- Reinheit:
- Purified by affinity chromatography from cell culture.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant protein corresponding to aa195-304 from human TPP1, fused to GST-Tag. MW of the GST-Tag alone is 26kD. Species sequence homology: mouse and rat
- Klon:
- 3B1
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Weitere Details:
- This gene encodes a member of the sedolisin family of serine proteases. The protease functions in the lysosome to cleave N-terminal tripeptides from substrates, and has weaker endopeptidase activity. It is synthesized as a catalytically-inactive enzyme which is activated and auto-proteolyzed upon acidification. Mutations in this gene result in late-infantile neuronal ceroid lipofuscinosis, which is associated with the failure to degrade specific neuropeptides and a subunit of ATP synthase in the lysosome. [provided by RefSeq]. Applications: Suitable for use in ELISA, Immunohistochemistry (paraffin), and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: GLHLGVTPSVIRKRYNLTSQDVGSGTSNNSQACAQFL EQYFHDSDLAQFMRLFGGNFAHQASVARVVGQQGR GRAGIEASLDVQYLMSAGANISTWVYSSPGRHEGQEP F Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice