551707
LYST
Größe
£843.00
- SKU:
- 551707
- Reinheit:
- Purified by affinity chromatography from cell culture.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant protein corresponding to aa1-100 from human LYST, from GST-Tag. MW of the GST tag alone is 26kD. Species sequence homology: mouse and rat
- Klon:
- 3H1
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Weitere Details:
- This gene is thought to encode a protein that regulates intracellular protein trafficking to and from the lysosome. Mutations in this gene are associated with Chediak-Higashi syndrome, a rare lysosomal storage disorder. Alternatively spliced transcript variants have been described but their full-length nature has not been determined. [provided by RefSeq]. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MSTDSNSLAREFLTDVNRLCNAVVQRVEAREEEEEET HMATLGQYLVHGRGFLLLTKLNSIIDQALTCREELLTLL LSLLPLVWKIPVQEEKATDFNLPL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice