FYN

Größe

£843.00

SKU:: 551677
Reinheit:: Purified by affinity chromatography from cell culture.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Full-length recombinant protein corresponding to aa1-482 from human FYN, fused to GST-Tag. MW of the GST-Tag alone is 26kD.
Klon:: 3G11-F9
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: This gene is a member of the protein-tyrosine kinase oncogene family. It encodes a membrane-associated tyrosine kinase that has been implicated in the control of cell growth. The protein associates with the p85 subunit of phosphatidylinositol 3-kinase and interacts with the fyn-binding protein. Alternatively spliced transcript variants encoding distinct isoforms exist. [provided by RefSeq]. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MWNLLHETDSAVATARRPRWLCAGALVLAGGFFLLGF LFGWFIKSSNEATNITPKHNMKAFLDELKAENIKKFLYN FTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHY DVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYE NVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLE RDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVIL YSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNG AGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYD AQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNF STQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGG HRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRP RRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYI NADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGF EGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFF QRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELV EKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRD YAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVK NFTEIASKFSERLQDFDKSKHVIYAPSSHNKYAGESFP GIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAE TLSEVA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Versandbedingungen:: Blue Ice