HNF1B, CT (HNF1 beta, FJHN, Hepatocyte Nuclear Factor 1 beta, Hepatocyte Nuclear Factor 1-beta, HNF 1B, HNF 2, HNF-1-beta, HNF-1B, HNF1 beta, HNF1 Homeobox B, HNF1B, HNF1beta, HNF2, Homeoprotein LF B3, Homeoprotein LFB3, HPC11, LF B3, LFB3, MODY 5, MODY5, TCF 2, TCF 2 Protein, TCF-2, TCF2, TCF2 Protein, Transcription Factor 2, Transcription Factor 2 Hepatic, Variant Hepatic Nuclear Factor 1, Variant Hepatic Nuclear Factor, VHNF 1, VHNF1)

Größe

£895.00

SKU:: 551141
Reinheit:: Purified by immunoaffinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Rabbit
Immunogen:: Hepatocyte nuclear factor 1β recombinant protein epitope signature tag (PrEST).
Format:: Supplied as a liquid in PBS, pH 7.2, 0.02% sodium azide, 40% glycerol.
Weitere Details:: HNF1B (hepatocyte nuclear factor 1 β), a homeodomain, is an atypical POU (Pit-1, Oct-1, andUnc-86) transcription factor which is associated with the early vertebrate development and embryonic survival. It is expressed in the pancreas, kidney, lung, ovary, testis, and throughout the gastrointestinal tract. Applications: Suitable for use in Immunofluorescence, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Western Blot: 0.04-0.4ug/ml Immunohistochemistry: 1:1000-1:2500 Immunofluorescence: 0.25-2ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: KEVLVQALEELLPSPNFGVKLETLPLSPGSGAEPDTKPVFHTLTNGHAKGRLSGDEGSEDGDDYDTPPILKELQALNTEEAAEQRAEVDRMLSEDPWRAAKMIKGYMQQH Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.