Nucleoside Diphosphate Kinase, Recombinant, Saccharomyces Cerevisiae, aa1-153, His-Sumo-Tag, Myc-Tag (YNK1)

Größe

£633.00

SKU:: 518027
Molekulargewicht:: 37.2
Reinheit:: ≥85% (SDS-PAGE)
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Format:: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
Weitere Details:: Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. Required for repair of UV radiation- and etoposide-induced DNA damage. Source: Recombinant full length protein corresponding to aa1-153 of Saccharomyces Cerevisiae Nucleoside Diphosphate Kinase, fused to 10xHis-Sumo-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E. coli. Molecular Weight: ~37.2kD Amino Acid Sequence: MSSQTERTFIAVKPDGVQRGLVSQILSRFEKKGYKLVAIKLVKADDKLLEQHYAEHVGKPFFPKMVSFMKSGPILATVWEGKDVVRQGRTILGATNPLGSAPGTIRGDFGIDLGRNVCHGSDSVDSAEREINLWFKKEELVDWESNQAKWIYE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.