517798
Alpha-Conotoxin VxXXC, Recombinant, Conus Vexillum, aa1-47, His-Sumo-Tag, Myc-Tag
Größe
£633.00
- SKU:
- 517798
- Molekulargewicht:
- 25.3
- Reinheit:
- ≥85% (SDS-PAGE)
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Format:
- Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
- Weitere Details:
- Alpha-conotoxins act on postsynaptic membranes, they bind to the nicotinic acetylcholine receptors (nAChR) and thus inhibit them. This toxin specifically blocks mammalian neuronal nAChR of the alpha-7/CHRNA7, alpha-3-beta-2/CHRNA3-CHRNB2 and alpha-4-beta-2/CHRNA4-CHRNB2 subtypes. VxXXA and VxXXB inhibit alpha-7/CHRNA7 and alpha-3-beta-2/CHRNA3-CHRNB2 nAChR more efficiently than VxXXC. VxXXB is the most effective at inhibiting alpha-4-beta-2/CHRNA4-CHRNB2 nAChR, followed by VxXXC and VxXXA. Full length recombinant protein corresponding to aa1-47 of Conus Vexillum Alpha-Conotoxin VxXXC, fused to 10X His-Sumo-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E. coli. Swiss/Uniprot: P0C1W7 Molecular Weight: ~25.3kD Amino Acid Sequence: DLRQCTRNAPGSTWGRCCLNPMCGNFCCPRSGCTCAYNWRRGIYCSC Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
- Versandbedingungen:
- Blue Ice