14kD Antigen, Recombinant, Mycobacterium Bovis, aa2-144, His-Tag (HspX)

Größe

£657.00

SKU:: 517775
Molekulargewicht:: 18.1
Reinheit:: ≥85% (SDS-PAGE)
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Format:: Supplied as a liquid in 10mM Tris-HCl, pH 8.0, 1mM EDTA, 10% glycerol.
Weitere Details:: Belongs to the small heat shock protein (HSP20) family. Source: Recombinant protein corresponding to aa2-144 of Mycobacterium Bovis (strain ATCC BAA-935 / AF2122/97) 14kD Antigen, fused to 9xHis-Tag at C-terminal, expressed in Baculovirus. Molecular Weight: ~18.1kD Amino Acid Sequence: ATTLPVQRHPRSLFPEFSELFAAFPSFAGLRPTFDTRLMRLEDEMKEGRYEVRAELPGVDPDKDVDIMVRDGQLTIKAERTEQKDFDGRSEFAYGSFVRTVSLPVGADEDDIKATYDKGILTVSVAVSEGKPTEKHIQIRSTN Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.