Leukocyte Surface CD47, Recombinant, Human, aa19-139, His-Tag (CD47)

Größe

£326.00

SKU:: 516811
Molekulargewicht:: 14.76
Reinheit:: ≥95% (SDS-PAGE)
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Format:: Supplied as a lyophilized powder from 20mM PBS, pH 7.2. Reconstitute with sterile ddH2O, 0.1% BSA to a concentration of 0.1-1.0mg/ml.
Weitere Details:: Has a role in both cell adhesion by acting as an adhesion receptor for THBS1 on platelets, and in the modulation of integrins. Plays an important role in memory formation and synaptic plasticity in the hippocampus (By similarity). Receptor for SIRPA, binding to which prevents maturation of immature dendritic cells and inhibits cytokine production by mature dendritic cells. Interaction with SIRPG mediates cell-cell adhesion, enhances superantigen-dependent T-cell-mediated proliferation and costimulates T-cell activation. May play a role in membrane transport and/or integrin dependent signal transduction. May prevent premature elimination of red blood cells. May be involved in membrane permeability changes induced following virus infection. Source: Recombinant partial protein corresponding to aa19-139 of human Leukocyte Surface CD47, fused to His-Tag at C-terminal, expressed in mammalian cell. Molecular Weight: ~14.76kD Biological Activity: The ED50 as determined by its ability to bind human SIRPA in functional ELISA is less than 20ug/ml. Endotoxin: <1EU/ug (LAL). AA Sequence: QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP Storage and Stability: Lyophilized powder may be stored at -20°C. Stable for 12 months after receipt at -20°C. Reconstitute with sterile buffer or ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Reconstituted product is stable for 6 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Versandbedingungen:: Blue Ice