TTC7A (Tetratricopeptide Repeat Protein 7A, Tetratricopeptide Repeat Domain 7A)

Größe

£614.00

SKU:: 494843
Anwendung:: WB
Reinheit:: Purified by affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Rabbit
Immunogen:: Synthetic peptide located within the following region: EAGEFLPKGYLALGLTYSLQATDATLKSKQDELHRKALQTLERAQQLAPS corresponding to the N-terminal region of human TTC7A. Species sequence homology: Bovine: 100%; Canine: 100%; Guinea Pig: 100%; Equine: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Format:: Supplied as a liquid in PBS, 2% sucrose, 0.09% sodium azide.
Weitere Details:: This gene encodes a protein containing tetratricopeptide repeats. Mutations in this gene disrupt intestinal development and can cause early onset inflammatory bowel disease and intestinal atresia. Alternative splicing results in multiple transcript variants. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.