494056
TMEM158 (Transmembrane Protein 158, Transmembrane Protein 158 (Gene/Pseudogene))
Größe
£614.00
- SKU:
- 494056
- Anwendung:
- WB
- Reinheit:
- Purified by affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide located within the following region: AHGRAFFAAAFHRVGPPLLIEHLGLAGGAQQDLRLCVGCGWVRGRRTGR to the middle region of human TMEM158. Sequence Homology: bovine, mouse, porcine and rat.
- Format:
- Supplied as a liquid in PBS, 2% sucrose, 0.09% sodium azide.
- Weitere Details:
- TMEM158 is the receptor for brain injury-derived neurotrophic peptide (BINP), a synthetic 13-mer peptide. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice