SYNPR (Synaptoporin)

Größe

£614.00

SKU:: 493245
Anwendung:: WB
Reinheit:: Purified by affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Rabbit
Immunogen:: Synthetic peptide within the following region: LVGDSSSSAEFFVTVAVFAFLYSLAATVVYIFFQNKYRENNRGPLIDFIV corresponding to a region of mouse SYNPR. Species Sequence Homology: human, rat, bovine, canine, guinea pig, equine, rabbit and zebrafish.
Format:: Supplied as a liquid in PBS, 2% sucrose, 0.09% sodium azide.
Weitere Details:: Synpr is the intrinsic membrane protein of small synaptic vesicles. Synpr is a probable vesicular channel protein. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.