491219
SCAMP5 (Secretory Carrier-Associated Membrane Protein 5, Secretory Carrier Membrane Protein 5)
Größe
£614.00
- SKU:
- 491219
- Anwendung:
- WB
- Reinheit:
- Purified by affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide located within the following region: VFSFIALSMVHKFYRGSGGSFSKAQEEWTTGAWKNPHVQQAAQNAAMGAA corresponding to the C-terminal of mouse SCAMP5. Species Sequence Homology: human, rat, bovine, canine guinea pig, equine, rabbit and zebrafish
- Format:
- Supplied as a liquid in PBS, 2% sucrose, 0.09% sodium azide.
- Weitere Details:
- Scamp5 is required for the calcium-dependent exocytosis of signal sequence-containing cytokines such as CCL5. It probably acts in cooperation with the SNARE machinery. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice