NPS (Neuropeptide S)

Größe

£614.00

SKU:: 487119
Anwendung:: WB
Reinheit:: Purified by affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Rabbit
Immunogen:: Synthetic peptide corresponding to the following region: LILVLSLSTMHVFWCYPVPSSKVSGKSDYFLILLNSCPTRLDRSKELAFL of Neuropeptide S at N-terminal. Species sequence homology: bovine, canine, guinea pig, mouse, rabbit and rat
Format:: Supplied as a liquid in PBS, 2% sucrose, 0.09% sodium azide.
Weitere Details:: NPS modulates arousal and anxiety. It may play an important anorexigenic role. It binds to its receptor NPSR1 with nanomolar affinity to increase intracellular calcium concentrations Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.