486990
NMRK2 (Nicotinamide Riboside Kinase 2, Integrin Beta 1 Binding Protein 3)
Größe
£614.00
- SKU:
- 486990
- Anwendung:
- WB
- Reinheit:
- Purified by affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide located within the following region: YKPLVDLYSRRYFLTVPYEECKWRRSTRNYTVPDPPGLFDGHVWPMYQKY corresponding to the middle region of human ITGB1BP3
- Format:
- Supplied as a liquid in PBS, 2% sucrose, 0.09% sodium azide.
- Weitere Details:
- ITGB1BP3 catalyzes the phosphorylation of nicotinamide riboside (NR) and nicotinic acid riboside (NaR) to form nicotinamide mononucleotide (NMN) and nicotinic acid mononucleotide (NaMN).ITGB1BP3 reduces laminin matrix deposition and cell adhesion to lami Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice