MYB (Transcriptional Activator Myb, V-myb Myeloblastosis Viral Oncogene Homolog (Avian))

Größe

£614.00

SKU:: 486358
Reinheit:: Purified by affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Rabbit
Immunogen:: Synthetic peptide mapping within the following sequence range on the N-terminal region of human MYB: YDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTD (aa26-75, UniProt Accession #P10242).
Format:: Supplied as a liquid in PBS, 2% sucrose, 0.09% sodium azide.
Weitere Details:: MYB may be a transcriptional activator; DNA-binding protein that specifically recognize the sequence 5'-YAAC[GT]G-3'. It plays an important role in the control of proliferation and differentiation of hematopoietic progenitor cells. Applications: Suitable for use in Immunohistochemistry, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.