MAPK1 (Mitogen-Activated Protein Kinase 1)

Größe

£614.00

SKU:: 485384
Anwendung:: WB
Reinheit:: Purified by affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Rabbit
Immunogen:: Synthetic peptide corresponding to a fragment of residues within the following region of the C-terminal region of mouse MAPK1: EVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETA. Species sequence homology: bovine, canine, goat, guinea pig, equine, human, porcine, rabbit, rat and zebrafish
Format:: Supplied as a liquid in PBS, 2% sucrose, 0.09% sodium azide.
Weitere Details:: Mapk1 is a serine/threonine kinase which acts as an essential component of the MAP kinase signal transduction pathway. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.