MAN1A2 (Mannosyl-Oligosaccharide 1,2-Alpha-Mannosidase IB, Mannosidase, Alpha, Class 1A, Member 2)

Größe

£614.00

SKU:: 485322
Anwendung:: WB
Reinheit:: Purified by affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Rabbit
Immunogen:: Synthetic peptide located within the following region: FALGADGSRADKAGHYLELGAEIARTCHESYDRTALKLGPESFKFDGAVE corresponding to the middle region of human MAN1A2. Species Sequence Homology: mouse, rat, bovine, canine, guinea pig, equine, rabbit and zebrafish
Format:: Supplied as a liquid in PBS, 2% sucrose, 0.09% sodium azide.
Weitere Details:: Alpha-mannosidases function at different stages of N-glycan maturation in mammalian cels. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.