LPPR3 (Lipid Phosphate Phosphatase-Related Protein Type 3)

Größe

£614.00

SKU:: 485007
Anwendung:: WB
Reinheit:: Purified by affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Rabbit
Immunogen:: Synthetic peptide located within the following region: APGPKAAETASSSSASSDSSQYRSPSDRDSASIVTIDAHAPHHPVVHLSA of human LPPR3. Species Sequence Homology: mouse, rat, canine, guinea pig, equine, and porcine.
Format:: Supplied as a liquid in PBS, 0.09% sodium azide, 2% sucrose.
Weitere Details:: The proteins in the lipid phosphate phosphatase (LPP) family, including PRG2, are integral membrane proteins that modulate bioactive lipid phosphates including phosphatidate, lysophosphatidate, and sphingosine-1-phosphate in the context of cell migration, neurite retraction, and mitogenesis。 Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilutions: Western Blot: 1ug/ml using Hela whole cell lysates Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.