LDHA (L-Lactate Dehydrogenase A Chain, Lactate Dehydrogenase A)

Größe

£614.00

SKU:: 484687
Reinheit:: Purified by affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Rabbit
Immunogen:: Synthetic peptide corresponding within the following region: ATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALV from the N-terminal region of human LDHA
Format:: Supplied as a liquid in PBS, 2% sucrose, 0.09% sodium azide.
Weitere Details:: LDHA catalyzes the conversion of L-lactate and NAD to pyruvate and NADH in the final step of anaerobic glycolysis. The protein is found predominantly in muscle tissue and belongs to the lactate dehydrogenase family. Mutations in this gene have been linked to exertional myoglobinuria. The protein encoded by this gene catalyzes the conversion of L-lactate and NAD to pyruvate and NADH in the final step of anaerobic glycolysis. The protein is found predominantly in muscle tissue and belongs to the lactate dehydrogenase family. Mutations in this gene have been linked to exertional myoglobinuria. Applications: Suitable for use in Immunohistochemistry and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.